thealpsltd.comALPS - Learning and Practice

thealpsltd.com Profile

thealpsltd.com is a domain that was created on 2019-05-17,making it 5 years ago. It has several subdomains, such as testseries.thealpsltd.com , among others.

Description:We are providing skill-based education and training in the field of IT and Non-IT (Technical &...

Discover thealpsltd.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site

thealpsltd.com Information

HomePage size: 389.856 KB
Page Load Time: 0.555835 Seconds
Website IP Address: 82.180.142.207

thealpsltd.com Similar Website

Oisans Valley: Outdoor Adventures in the French Alps
uk.oisans.com
Bike Oisans | All the info on mountain biking and cycling in Oisans in the French Alps
uk.bike-oisans.com
Deep Learning Garden – Liping's machine learning, computer vision, and deep learning home: resources
deeplearning.lipingyang.org
Summit Learning Blog – The Summit Learning Blog covers stories and insights from the Summit Learning
blog.summitlearning.org
Daesign | E-learning, blended learning, rapid learning & webinars
en.daesign.com
My Swiss Kitchen - Feeding Foodies in the Alps
myswisskitchen.swisshikingvacations.com
Physicians Practice: America's Practice Management Resource | Physicians Practice
buyers-guide.physicianspractice.com
Perkins and Will Research | Practice-Informed Research for a Research-Informed Practice
researchlabs.perkinswill.com
Learning Management System-Learning Content Management System-LMS-LCMS, e-Learning Management Soluti
portal.syberworks.com
The Alps Trail Running Guide
elevation.alpsinsight.com
The Alpine Property Blog - Selling properties in the Alps since 1999
blog.alpine-property.com
Alps Tour Golf |
wp-alpstour.ocs-sport.com
Alps
testseries.thealpsltd.com

thealpsltd.com PopUrls

ALPS - Learning and Practice School
https://www.thealpsltd.com/
Courses - ALPS
https://www.thealpsltd.com/courses/
About Us - ALPS
https://www.thealpsltd.com/about-us/
Student Registration - ALPS
https://www.thealpsltd.com/student-registration/
Videos - ALPS
https://www.thealpsltd.com/videos/
Director Message - ALPS
https://www.thealpsltd.com/director-message/
School Education - ALPS
https://www.thealpsltd.com/courses/school-education/
University Education - ALPS
https://www.thealpsltd.com/university-education/
IT Training Programs | ALPS - Learning and Practice School
https://www.thealpsltd.com/i-t-training-programs/
FAQ's - ALPS
https://www.thealpsltd.com/faqs/
Soft Skills Training - ALPS
https://www.thealpsltd.com/soft-skills-training/
Noticeboard - ALPS
https://www.thealpsltd.com/noticeboard/
Competitive Exams - ALPS
https://www.thealpsltd.com/competitive-exams/
Certificate In MS - Excel - ALPS
https://www.thealpsltd.com/courses/ms-excel/
Computer Fundamental - Theory - ALPS
https://www.thealpsltd.com/course-category/computer-fundamental-theory/

thealpsltd.com DNS

A thealpsltd.com. 1800 IN A 82.180.142.207
AAAA thealpsltd.com. 1800 IN AAAA 2a02:4780:11:979:0:1cc5:880f:3
MX thealpsltd.com. 300 IN MX 20 mx2.zoho.in.
NS thealpsltd.com. 21600 IN NS ns1.dns-parking.com.
TXT thealpsltd.com. 14400 IN TXT v=spf1 include:_spf.mail.hostinger.com ~all
SOA thealpsltd.com. 3600 IN SOA ns1.dns-parking.com. dns.hostinger.com. 2024051601 10000 2400 604800 600

thealpsltd.com Httpheader

Connection: Keep-Alive
Keep-Alive: timeout=5, max=100
x-powered-by: PHP/7.4.33
content-type: text/html; charset=UTF-8
link: https://www.thealpsltd.com/wp-json/; rel="https://api.w.org/", https://www.thealpsltd.com/wp-json/wp/v2/pages/4520; rel="alternate"; type="application/json", https://www.thealpsltd.com/; rel=shortlink
etag: "4294-1715870425;;;"
x-litespeed-cache: hit
transfer-encoding: chunked
date: Thu, 16 May 2024 15:43:23 GMT
server: LiteSpeed
platform: hostinger
content-security-policy: upgrade-insecure-requests
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000;

thealpsltd.com Meta Info

charset="utf-8"/
content="width=device-width, initial-scale=1" name="viewport"/
content="index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1" name="robots"
content="We are providing skill-based education and training in the field of IT and Non-IT (Technical & Non-Technical) Education..." name="description"
content="en_US" property="og:locale"/
content="website" property="og:type"/
content="ALPS - Learning and Practice School" property="og:title"/
content="We are providing skill-based education and training in the field of IT and Non-IT (Technical & Non-Technical) Education..." property="og:description"/
content="https://www.thealpsltd.com/" property="og:url"/
content="ALPS" property="og:site_name"/
content="https://www.facebook.com/alpslearninginstitute/" property="article:publisher"/
content="2024-04-25T10:42:27+00:00" property="article:modified_time"/
content="https://www.thealpsltd.com/wp-content/uploads/2022/03/ALPS-Logo.png"

thealpsltd.com Ip Information

Ip Country: India
City Name: Mumbai
Latitude: 19.0748
Longitude: 72.8856

thealpsltd.com Html To Plain Text

School Back HomeDirector Message Team Members Online Courses Training Programs I.T Training Programs Diploma in Computer Application (DCA) Certificate In Basic Computer Certificate In Basic Computer & Tally with GST Certificate In DTP (Desktop Publishing) IT Designing Services Financial Accounting Certificate In Tally with GST Diploma In Financial Accounting Desktop Publishing Auto Cad Fashion Designing Course Diploma In Cutting and Tailoring Diploma In Fashion Designing Soft Skills Training University Education Competitive Exams Student Enquiry Here Noticeboard Admit Card Certificate Download Franchise Zone Apply For Franchise Franchise Login Franchise Verification Study Centre List Centre Login Student Zone Student Login Download Admit Card Online Admission Enrollment Verification Result Verification Gallery Contact Have any question? (+91)- 81818-32000 info@thealpsltd.com TEST SERIES Register LoginHomeDirector Message Team Members Online Courses Training Programs I.T Training Programs Diploma in Computer Application (DCA) Certificate In Basic Computer Certificate In Basic Computer & Tally with GST Certificate In DTP (Desktop Publishing) IT Designing Services Financial Accounting Certificate In Tally with GST Diploma In Financial Accounting Desktop Publishing Auto Cad Fashion Designing Course Diploma In Cutting and Tailoring Diploma In Fashion Designing Soft Skills Training University Education Competitive Exams Student Enquiry Here Noticeboard Admit Card Certificate Download Franchise Zone Apply For Franchise Franchise Login Franchise Verification Study Centre List Centre Login Student Zone Student Login Download Admit Card Online Admission Enrollment Verification Result Verification Gallery Contact Skills don’t die; only people do. Learn more Your skill can be either an asset or a liability. Learn more Human skill development in any nation is key for economic growth.” Learn more Share your knowledge to the world Learn more Title of the document Welcome To ALPS | For More Information about any Query. Contact Us at:- +91- 818 1832 000 Welcome To ALPS - Learning and Practice SchoolWe are providing skill based education and training in the field of I T and Non-IT (Technical & Non-Technical) Education with short – term and long – term period for the upliftment of our educated youth and motivate them for employment and self employment generation. Establish quality based Education Institute / Skill Empowerment Schools to provide quality based skilled education. Read MoreOur Online Courses Add to cart Alps Team Diploma in Cutting and Tailoring Alps Team 53 Students 0 student ₹26,000 ₹18,550 Add to cart Alps Team School Education Alps Team 121 Students 0 student ₹30,000 Add to cart Alps Team Diploma In Web Designing Alps Team 347 Students 0 student ₹44,000 ₹36,100 Alps Team Demo Course Alps Team 36 Students 7 students Free Add to cart Alps Team Diploma In Fashion Designing Alps Team 266 Students 0 student ₹45,000 ₹35,200 Add to cart Alps Team Diploma In Computer Application Alps Team 280 Students 81 students ₹31,100 ₹28,000 Add to cart Alps Team Certificate In Desktop Publishing Alps Team 86 Students 5 students ₹15,000 ₹12,700 Add to cart Alps Team Certificate In Basic Computer Alps Team 98 Students 10 students ₹10,000 ₹8,200 Add to cart Alps Team Certificate In Basic Computer and Tally with GST Alps Team 170 Students 5 students ₹20,000 ₹18,100 Add to cart Alps Team Certificate In Sketch(Illustration) Alps Team 1 Students 2 students ₹10,000 Popular Courses Popular Courses We Provide Offline & Online Classes. Add to cart Alps Team Advance Diploma in Financial Accounting – ADFA Alps Team 121 Students 303 students ₹45,000 ₹35,200 Add to cart Alps Team Certificte In Tally With GST Alps Team 72 Students 83 students ₹10,000 Add to cart Alps Team Diploma In Computer Application Alps Team 280 Students 81 students ₹31,100 ₹28,000 Add to cart Alps Team Certificate In Computer Fundamental – Theory Alps Team 19 Students 70 students ₹5,000 Our Services I.T Training Programs Click here for More Details Fashion Designing Click here for More Details Financial Accounting Click here for More Details Soft Skills Training Click here for More Details University Education Click here for More Details Competitive Exams Click here for More Details Training Centers 0 + Online Courses 0 + Mock test Series 0 + Academic Videos (Nursery to 12th) 0 + Our Students Google Review      4.5/5 A L P S – Govt. Approved Best Computer Training Institute Center Govt Approved Courses (IT & Non IT) 4.9 Based on 278 reviews review us on 20hind118 Priya thakur 10:57 26 Sep 22 Alps Institute is best institute in kullu Dist. Here staff and teachers are very friendly. I suggest u you will come and study here Nisha Thakur 10:44 29 Aug 22 iam studying in alps institute from 1month …I am very happy that I choose thi s institute for study …the teachers are very helpful and kind ….they teach us very kindly …and their teaching method is very good and easy…I love one thing most about this institute is the discipline of the institute…I just want to say thanks to all the teachers of alps institute..thanku It’s Me 11:25 27 Aug 22 Alps institute is one of the best institute in kullu for learning . The staff also is very good. There behaviour towards the students is also good . TanyA Thakur 09:26 27 Aug 22 Nice institute.All the teachers are very amazing.Learning new things with the help of this amazing computer institute… Diksha kumari 07:31 19 Jul 22 Alps institutions is the best institution fir learning computer is kullu. All staff teachers are very helpful and lovely. Facebook Review      4.5/5 Alps Learning and Practice School 55 Facebook reviews Write a review Kartik Mahant 2022-09-19 recommends Govt. approved institute in kullu.Bestteaching faculty.very good environment. Çrûzêr Bõbby Dõdã 2022-09-14 recommends Best teaching faculty. Govt. approved institute in kullu. Rana Abhi 2022-09-03 recommends i good experine in this institute Preety Dhiman 2022-09-02 recommends It’s very nice to learn here. All teachers works well and they also give there 100 % . I am happy to come here and learn about computer. Situ Kaushal 2022-08-30 recommends Amazing learning experience Añß Hul 2022-08-29 recommends This is the best institute for computer courses . In this institution staff is very intelligent ☺️☺️ Nisha Thakur 2022-08-29 recommends iam studying in alps institute from 1month ...I am very happy that I choose thi s institute for study ...the teachers are very helpful and kind ....they teach us very kindly ...and their teaching method is very good and easy...I love one thing most about this institute is the discipline of the institute...I just want to say thanks to all the teachers of alps institute..thanku ÑêGį Jřb 2022-08-29 recommends Best teaching method ...... Chetna Himachali 2022-08-29 recommends Alps is very good institute .. and there is two teacher give as good information and halpull teacher . Råthøŕə K Iråñ 2022-08-29 recommends Institute teachers is very nice. It’s behavior is nice to student than i like this Institute Justdial Review      4.5/5 Tanisha      Read More This Institute is very good. The teachers of this institute is well educated. Naina      Read More ALPS Institute is one of the best Institute in Kullu . Skalzang      Read More Great teaching staff , great facilities and curriculum Virender      Read More Best teaching faculty.Govt approved institute in Kullu. Sonia Kumari      Read More I am very happy that I join ALPS Institute for my DCA course. The teachers are very humble and supportive. Laksh      Read More Best Govt. Approved institute in Kullu. Best Teaching Faculty. Tanvi      Read More The institute and the teaching skills of all the teachers is very nice. Best institute in kullu. Laxmi      Read More The institute is too good. Teachers are also good and talk very nicely to students. Aanchal      Read More...

thealpsltd.com Whois

Domain Name: THEALPSLTD.COM Registry Domain ID: 2391782815_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2024-03-31T07:14:27Z Creation Date: 2019-05-17T09:51:11Z Registry Expiry Date: 2026-05-17T09:51:11Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: 480-624-2505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NS1.DNS-PARKING.COM Name Server: NS2.DNS-PARKING.COM DNSSEC: unsigned >>> Last update of whois database: 2024-05-18T07:22:11Z <<<